PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_12894
Common NameKK1_013291
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family CPP
Protein Properties Length: 492aa    MW: 53295.1 Da    PI: 7.6052
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_12894genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR46.29.3e-15847242
            TCR  2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42
                   ++k+CnCk+skClk+YCeCfa+g +C+  C+C +C+N+ e+
  C.cajan_12894  8 KQKQCNCKHSKCLKLYCECFASGIYCDG-CNCVNCFNNVEN 47
                   89**************************.********9875 PP

2TCR51.22.4e-1692131140
            TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                    k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  C.cajan_12894  92 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 131
                    589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.2E-17747IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.7618132IPR005172CRC domain
PfamPF036382.4E-11944IPR005172CRC domain
SMARTSM011148.4E-2092133IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.1E-1395130IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MKDATPKKQK QCNCKHSKCL KLYCECFASG IYCDGCNCVN CFNNVENEAS RREAVEATLE  60
RNPNAFRPKI ASSPHGTHDS REETGEVLIL GKHNKGCHCK KSGCLKKYCE CFQANILCSE  120
NCKCMDCKNF EGSEERQALF HGDQNNMAYI QQAANAAITG AIGSSGYLSP PVSKKRKGQE  180
LFFWPTTKDP SVSKLGQQVN NVRGPAPSSS LSPVPGARVG TATLGPSKFM YRSLLADIIQ  240
PQHLKELCSV LVLVSGQAAK TLTDQKNLLE KHAEDQTETS LASSSQEQLP NQKQGHVEKT  300
VADDCSSANQ TDKVSPDNSS SDNSSSDGAD VPKGRPMSPG TLALMCDEQD TMFMTTASPI  360
GPMAHRNTSS QFPYGQGMTE VYAEQERIVL TKFRDFLNRV ITMGEINGKL IFSSVETKCS  420
SFARNELESQ KDPIIKCIGS ASSEIVRQQG VTSNGVSVTK SVVSPAATTS ASLIPGNIAE  480
NGETKVKIEK EI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-163AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003529992.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X1
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A151TIT80.0A0A151TIT8_CAJCA; Protein lin-54 isogeny
STRINGGLYMA07G09380.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26263379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-168Tesmin/TSO1-like CXC domain-containing protein